PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma1077g00030.1
Common NameZOSMA_1077G00030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 391aa    MW: 43981.1 Da    PI: 7.1431
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma1077g00030.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.51.1e-083153502055
                        HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
           Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +k +yps+ e+  LA+++gL+++q+ +WF N+R ++
  Zosma1077g00030.1 315 YKWPYPSEMEKLALAESTGLDQKQINNWFINQRKRH 350
                        4679*****************************885 PP

2ELK377.4e-13270291122
                ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                        ELKh+Ll+KYsgyL+sLkqE+s
  Zosma1077g00030.1 270 ELKHHLLKKYSGYLSSLKQELS 291
                        9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-22125169IPR005540KNOX1
PfamPF037901.5E-23126167IPR005540KNOX1
SMARTSM012562.4E-23177228IPR005541KNOX2
PfamPF037911.5E-21182227IPR005541KNOX2
PfamPF037899.0E-10270291IPR005539ELK domain
SMARTSM011884.9E-7270291IPR005539ELK domain
PROSITE profilePS5121311.331270290IPR005539ELK domain
PROSITE profilePS5007112.973290353IPR001356Homeobox domain
SuperFamilySSF466895.56E-19291361IPR009057Homeodomain-like
SMARTSM003891.3E-12292357IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.6E-27295354IPR009057Homeodomain-like
CDDcd000862.45E-12302354No hitNo description
PfamPF059203.7E-16310349IPR008422Homeobox KN domain
PROSITE patternPS000270328351IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MEEFSQSQLG VSINTTTTTT ARAGAGVYIY GGSSSSSAPS TVAPHPPAGS SSMYGGRQFN  60
INMHQQHLPL SDPFQHLVSE TTTMPCSAKS EDGCSRNTQH QIHYPFGIIR SGGQDSTSSQ  120
YHHADAIKAK IISHPQYSNL LQAYMDCQKV GAPPEVVARL TAITRDFESR QQQTIIGRDL  180
SSNDPELNQF MEAYYDMLVK YREELTRPLQ EAMDFLRRVE SQLSVLTNGS ARVFSPDKKS  240
EGPGSSDDDQ EGSGGETELP EIDPRAEDKE LKHHLLKKYS GYLSSLKQEL SKKKKKGKLP  300
KEARQKLLNW WELHYKWPYP SEMEKLALAE STGLDQKQIN NWFINQRKRH WKPSDMQFVV  360
MDGYHPQNTS AFYMDGHHHF MGDGSYRLGP *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006472353.11e-151PREDICTED: homeotic protein knotted-1
SwissprotQ413301e-145KN1_SOLLC; Homeotic protein knotted-1
TrEMBLA0A0K9Q4I60.0A0A0K9Q4I6_Z
STRINGVIT_18s0001g08380.t011e-150(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-105KNOTTED-like from Arabidopsis thaliana